Please wait a bit while StatShow is computing website's data...

Domain Ownership Lookup arrow stephanie domains

Results of domain names owned by "stephanie" (Person or Organization)

 Page 37 of 1,197 results

#13,962,324 (+69%) - 30shadesofstephanie.com
Owner: STEPHANIE FERGUSON
Title: 30 Shades Of Stephanie - A Life and Style Blog
Description: A life and style blog. Featuring fashion, food and travel, with lot's of local style.
Keywords:Not available
#0 (0%) - sketchesbysteffi.com
Owner: Stephanie Fermazi
Title: sketches by steffi | PORTRAITS IN MONOCHROME
Description: Not available
Keywords:Not available
#5,508,471 (-4%) - quasemineira.com.br
Owner: Stephanie Ferreira
Title: Quase Mineira
Description: Cotidiano & Lifestyle - Uma Paulista em Poços de Caldas
Keywords:Not available
#19,264,277 (0%) - blueoceaneventsnj.com
Owner: Stephanie Fetterer
Title: Home - NJ Events
Description: NJ Event Planning Company
Keywords:Not available
#6,780,516 (-7%) - mutmach-geschichten.biz
Owner: Stephanie Feyerabend
Title: Hürden, Tiefen oder Scheitern in der Selbstständigkeit
Description: Buch über Hürden, Tiefen oder Scheitern in der Selbstständigkeit. Mutmach-Geschichten von Unternehmerinnen für Unternehmerinnen
Keywords:Not available


Not available.
#15,567,973 (-49%) - stephaniefierman.com
Owner: Stephanie Fierman
Title: Stephanie Fierman - Marketing Mojo
Description: Marketing guru Stephanie Fierman blogs on business and marketing trends
Keywords:Marketing Mojo LLC, stephanie fierman, branding, marketing, customer experience, customer service, advertising, comics, direct marketing, promotion, customer relationship management, internet, social media, internet marketing, reputation, search marketing, seo, sem, crm


Not available.
#16,751,439 (0%) - stephaniefiermanmarketingdaily.com
Owner: Stephanie Fierman
Title: Stephanie Fierman - Marketing Observations Grown Daily
Description: Marketing guru Stephanie Fierman blogs about the art and science of connecting with consumers.
Keywords:Stephanie Fierman – Marketing Observation, stephanie fierman, stephanie fierman dc comics, branding, marketing, customer experience, customer service, advertising, direct marketing, promotion, customer relationship management, crm, social media, engagement, digital marketing, personal branding, reputation management
#0 (0%) - dieticiantoday.com
Owner: Stephanie Figon
Title: 503 Service Unavailable
Description: Not available
Keywords:Not available
#24,835,464 (0%) - halobyshoshana.com
Owner: Stephanie Finkelstein
Title: Halo By Shoshana - Welcome
Description: Not available
Keywords:Not available
#6,881,548 (0%) - steffiejean.com
Owner: Stephanie Finley
Title: Database Error
Description: Not available
Keywords:Not available
< Previous  32 33 34 35 36 37 38 39 40 41  Next >